PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D11G2407
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 317aa    MW: 35698.1 Da    PI: 8.2422
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D11G2407genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.23.4e-172673148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT+eEde l++++k+ G g+W+t +++ g+ R++k+c++rw +yl
      Gh_D11G2407 26 RGPWTPEEDEVLANYIKREGEGRWRTLPKRAGLLRCGKSCRLRWMNYL 73
                     89******************************99************97 PP

2Myb_DNA-binding48.32.3e-1579124148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rgr  ++E++l+++++++lG++ W++Ia +++ gRt++++k++w+++l
      Gh_D11G2407  79 RGRIAPDEEDLILRLHRLLGNR-WSLIAGRIP-GRTDNEIKNYWNTHL 124
                      678889****************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.5E-221775IPR009057Homeodomain-like
PROSITE profilePS5129415.7082173IPR017930Myb domain
SuperFamilySSF466891.39E-2823120IPR009057Homeodomain-like
SMARTSM007172.9E-122575IPR001005SANT/Myb domain
PfamPF002496.7E-152673IPR001005SANT/Myb domain
CDDcd001671.06E-92873No hitNo description
PROSITE profilePS5129424.57874128IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.4E-2476129IPR009057Homeodomain-like
SMARTSM007173.4E-1478126IPR001005SANT/Myb domain
PfamPF002497.2E-1480124IPR001005SANT/Myb domain
CDDcd001676.85E-1184124No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 317 aa     Download sequence    Send to blast
MKNPSLVGNS TSSKGTPCCS KVGIKRGPWT PEEDEVLANY IKREGEGRWR TLPKRAGLLR  60
CGKSCRLRWM NYLRPSVKRG RIAPDEEDLI LRLHRLLGNR WSLIAGRIPG RTDNEIKNYW  120
NTHLSKKLIS QGIDPRTHKP LNLITDKSPQ INHDPVPKSN PSPPIPNPSV LASKTITIKT  180
TNTTKDGTPT NLEHGYQQQS QNQQVDKSME KRHYTESATL IMGEPSSHGN EGDHMENCNE  240
DMFSSFLDSL INENLLVNQH PEEQQPNNLV AQAAAAAESS QNLSHGDMWE TELISAMVGF  300
GNEPNSFNNH YHYLHQL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-24261287108B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012492537.10.0PREDICTED: transcription repressor MYB5-like
SwissprotQ388501e-83MYB5_ARATH; Transcription repressor MYB5
TrEMBLA0A0D2SRF20.0A0A0D2SRF2_G
STRINGPOPTR_0013s05300.11e-108(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13540.14e-81myb domain protein 5